Mouse Anti-Rat Pgk1 Antibody (MO-AB-27839H)


Cat: MO-AB-27839H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO27839C
SpecificityThis antibody binds to Rat Pgk1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. Additionally, this protein is secreted by tumor cells where it participates in angiogenesis by functioning to reduce disulfide bonds in the serine protease, plasmin, which consequently leads to the release of the tumor blood vessel inhibitor angiostatin. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Deficiency of the enzyme is associated with a wide range of clinical phenotypes hemolytic anemia and neurological impairment. Pseudogenes of this gene have been defined on chromosomes 19, 21 and the X chromosome.
Product OverviewThis product is a mouse antibody against Pgk1. It can be used for Pgk1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosphoglycerate kinase 1; Pgk1
UniProt IDA0A096MJL6
Protein RefseqThe length of the protein is 57 amino acids long.
The sequence is show below: XFARGTKSLMDEVVKATSRGCITIIEDKVSHVSTGGGASLELLEGKVLPGVDALSNV.
For Research Use Only | Not For Clinical Use.
Online Inquiry