Mouse Anti-Rat Pgk1 Antibody (MO-AB-27839H)
Cat: MO-AB-27839H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO27839C |
Specificity | This antibody binds to Rat Pgk1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. Additionally, this protein is secreted by tumor cells where it participates in angiogenesis by functioning to reduce disulfide bonds in the serine protease, plasmin, which consequently leads to the release of the tumor blood vessel inhibitor angiostatin. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Deficiency of the enzyme is associated with a wide range of clinical phenotypes hemolytic anemia and neurological impairment. Pseudogenes of this gene have been defined on chromosomes 19, 21 and the X chromosome. |
Product Overview | This product is a mouse antibody against Pgk1. It can be used for Pgk1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Phosphoglycerate kinase 1; Pgk1 |
UniProt ID | A0A096MJL6 |
Protein Refseq | The length of the protein is 57 amino acids long. The sequence is show below: XFARGTKSLMDEVVKATSRGCITIIEDKVSHVSTGGGASLELLEGKVLPGVDALSNV. |
See other products for " PGK1 "
MO-DKB-01211W | Rabbit Anti-PGK1 Antibody (MO-DKB-01211W) |
MO-AB-32689W | Mouse Anti-Dog PGK1 Antibody (MO-AB-32689W) |
MO-DKB-01909W | Rabbit Anti-PGK1 Antibody (MO-DKB-01909W) |
MO-AB-06206H | Mouse Anti-Frog pgk1 Antibody (MO-AB-06206H) |
MO-AB-28238R | Mouse Anti-Pig PGK1 Antibody (MO-AB-28238R) |
CBMOAB-54361FYA | Mouse Anti-Rhesus PGK1 Antibody (CBMOAB-54361FYA) |
CBMOAB-92326FYA | Mouse Anti-Zebrafish pgk1 Antibody (CBMOAB-92326FYA) |
MO-AB-46018W | Mouse Anti-Horse PGK1 Antibody (MO-AB-46018W) |
MO-AB-43356W | Mouse Anti-Hamsters PGK1 Antibody (MO-AB-43356W) |
MO-AB-61379W | Mouse Anti-Marmoset PGK1 Antibody (MO-AB-61379W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry