Mouse Anti-Rat Rps27a Antibody (MO-AB-28670H)
Cat: MO-AB-28670H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO28670C |
Specificity | This antibody binds to Rat Rps27a. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Cytosol; Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. Multiple alternatively spliced transcript variants that encode the same proteins have been identified. |
Product Overview | This product is a mouse antibody against Rps27a. It can be used for Rps27a detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ubiquitin-40S ribosomal protein S27a; Ubiquitin carboxyl extension protein 80; [Cleaved into: Ubiquitin; 40S ribosomal protein S27a]; Rps27a |
UniProt ID | P62982 |
Protein Refseq | The length of the protein is 156 amino acids long. The sequence is show below: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKPEDK. |
See other products for " RPS27A "
CBMOAB-40700FYC | Mouse Anti-Arabidopsis RPS27A Antibody (CBMOAB-40700FYC) |
MO-AB-42489W | Mouse Anti-Guinea pig RPS27A Antibody (MO-AB-42489W) |
MO-NAB-00076W | Mouse Anti-Zebrafish RPS27A Antibody (MO-NAB-00076W) |
CBMOAB-03621CR | Mouse Anti-Yeast RPS27A Antibody (CBMOAB-03621CR) |
MO-AB-07292H | Mouse Anti-Frog rps27a Antibody (MO-AB-07292H) |
CBMOAB-30122FYA | Mouse Anti-D. melanogaster Rps27A Antibody (CBMOAB-30122FYA) |
CBMOAB-96542FYA | Mouse Anti-Zebrafish rps27a Antibody (CBMOAB-96542FYA) |
MO-AB-19567R | Mouse Anti-Cattle RPS27A Antibody (MO-AB-19567R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry