Mouse Anti-Yeast RPS27A Antibody (CBMOAB-03621CR)
Cat: CBMOAB-03621CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast |
Clone | MO03621CR |
Specificity | This antibody binds to Yeast RPS27A. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. |
Product Overview | Mouse Anti-Yeast RPS27A Antibody is a mouse antibody against RPS27A. It can be used for RPS27A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 40S ribosomal protein S27-A; RP61; YS20; RPS27A; YKL156W |
UniProt ID | P35997 |
Protein Refseq | The length of the protein is 82 amino acids long. The sequence is show below: MVLVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQTAVTCESCSTILCTPTGGKAKLSEGTSFRRK. |
See other products for " RPS27A "
MO-AB-42489W | Mouse Anti-Guinea pig RPS27A Antibody (MO-AB-42489W) |
CBMOAB-96542FYA | Mouse Anti-Zebrafish rps27a Antibody (CBMOAB-96542FYA) |
MO-AB-19567R | Mouse Anti-Cattle RPS27A Antibody (MO-AB-19567R) |
CBMOAB-30122FYA | Mouse Anti-D. melanogaster Rps27A Antibody (CBMOAB-30122FYA) |
MO-NAB-00076W | Mouse Anti-Zebrafish RPS27A Antibody (MO-NAB-00076W) |
MO-AB-07292H | Mouse Anti-Frog rps27a Antibody (MO-AB-07292H) |
MO-AB-28670H | Mouse Anti-Rat Rps27a Antibody (MO-AB-28670H) |
CBMOAB-40700FYC | Mouse Anti-Arabidopsis RPS27A Antibody (CBMOAB-40700FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry