Mouse Anti-Rat sfrp2 Antibody (MO-AB-28943H)
Cat: MO-AB-28943H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO28943C |
Specificity | This antibody binds to Rat sfrp2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer. |
Product Overview | This product is a mouse antibody against sfrp2. It can be used for sfrp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Putative secreted frizzled related protein; Sfrp2; sfrp2 |
UniProt ID | Q80W55 |
Protein Refseq | The length of the protein is 77 amino acids long. The sequence is show below: KTIYKLNGVSDRDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC. |
See other products for " sfrp2 "
CBMOAB-97900FYA | Mouse Anti-Zebrafish sfrp2 Antibody (CBMOAB-97900FYA) |
MO-AB-23709H | Mouse Anti-Mallard SFRP2 Antibody (MO-AB-23709H) |
CBMOAB-57569FYA | Mouse Anti-Rhesus SFRP2 Antibody (CBMOAB-57569FYA) |
MO-AB-07574H | Mouse Anti-Frog sfrp2 Antibody (MO-AB-07574H) |
MO-AB-33303W | Mouse Anti-Dog SFRP2 Antibody (MO-AB-33303W) |
MO-AB-20035R | Mouse Anti-Cattle SFRP2 Antibody (MO-AB-20035R) |
MO-AB-17602Y | Mouse Anti-Sheep SFRP2 Antibody (MO-AB-17602Y) |
MO-AB-03945Y | Mouse Anti-Chicken SFRP2 Antibody (MO-AB-03945Y) |
MO-AB-64247W | Mouse Anti-Marmoset SFRP2 Antibody (MO-AB-64247W) |
MO-AB-20115W | Mouse Anti-Chimpanzee SFRP2 Antibody (MO-AB-20115W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry