Mouse Anti-Rat Wnt2 Antibody (MO-AB-30048H)
Cat: MO-AB-30048H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO30048C |
Specificity | This antibody binds to Rat Wnt2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Alternatively spliced transcript variants have been identified for this gene. |
Product Overview | This product is a mouse antibody against Wnt2. It can be used for Wnt2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein Wnt; Wnt2 |
UniProt ID | Q99MC1 |
Protein Refseq | The length of the protein is 82 amino acids long. The sequence is show below: LRSSRESAFVYAISSAGVVFAITRACSQGELKSCSCDPKKKGSGKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGKNAR. |
See other products for " WNT2 "
CBMOAB-13266HCB | Mouse Anti-C. elegans WNT2 Antibody (CBMOAB-13266HCB) |
MO-AB-23892H | Mouse Anti-Mallard WNT2 Antibody (MO-AB-23892H) |
MO-AB-34061W | Mouse Anti-Dog WNT2 Antibody (MO-AB-34061W) |
MO-AB-34033H | Mouse Anti-Nile tilapia wnt2 Antibody (MO-AB-34033H) |
MO-AB-04784Y | Mouse Anti-Chicken WNT2 Antibody (MO-AB-04784Y) |
CBMOAB-16309FYB | Mouse Anti-Zebrafish wnt2 Antibody (CBMOAB-16309FYB) |
MO-AB-07005Y | Mouse Anti-O. anatinus WNT2 Antibody (MO-AB-07005Y) |
MO-AB-22982R | Mouse Anti-Cattle WNT2 Antibody (MO-AB-22982R) |
MO-AB-08781W | Mouse Anti-Cat WNT2 Antibody (MO-AB-08781W) |
MO-AB-20725W | Mouse Anti-Chimpanzee WNT2 Antibody (MO-AB-20725W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry