AibGenesis™ Mouse Anti-RBMY Antibody (CBMOAB-56225FYA)


Cat: CBMOAB-56225FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56225FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Marmoset WB, ELISA MO56225FYA 100 µg
MO-AB-08760W Monoclonal Cat (Felis catus) WB, ELISA MO08760W 100 µg
MO-AB-19130R Monoclonal Cattle (Bos taurus) WB, ELISA MO19130R 100 µg
MO-AB-63102W Monoclonal Marmoset WB, ELISA MO63102W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Marmoset
CloneMO56225FYA
SpecificityThis antibody binds to Rhesus RBMY.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RBMY Antibody is a mouse antibody against RBMY. It can be used for RBMY detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTruncated RNA binding motif protein Y-linked; RBMY
UniProt IDB8YE06
Protein RefseqThe length of the protein is 231 amino acids long.
The sequence is show below: MVEADHPGKLFIGGLTRKTNEKMLKAVFVKHGPISEVLLIKDRTRKSRGFAFVTFENPEDAKNAAKDMNGKSLDGKAIKVEQAKKPSFQSGGRQRPPPSSRNRSPSGSLRSAKGSSGGTKGWHPSHEGHLDDGGYTLDLNMSSSEGHIPVKRHPSSRSGGPPPKKSSPSAVARSNNWMGGQGPVSHGRRIMEVLHTESRPLHGEMTICYQEMMVIQISSKLPRNQRLCSTI.
For Research Use Only | Not For Clinical Use.
Online Inquiry