Mouse Anti-RBP4 Antibody (MO-AB-46323W)


Cat: MO-AB-46323W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-46323W Monoclonal Horse (Equus caballus), Bovine, Human, Mouse, Pig, Goat, Sheep, Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO46323W 100 µg
Inquiry
CBMOAB-56227FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO56227FYA 100 µg
Inquiry
CBMOAB-95538FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95538FYA 100 µg
Inquiry
MO-AB-08145W Monoclonal Cat (Felis catus) WB, ELISA MO08145W 100 µg
Inquiry
MO-AB-19633W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19633W 100 µg
Inquiry
MO-AB-63103W Monoclonal Marmoset WB, ELISA MO63103W 100 µg
Inquiry
MO-AB-19138R Monoclonal Cattle (Bos taurus) WB, ELISA MO19138R 100 µg
Inquiry
MO-AB-28769R Monoclonal Pig (Sus scrofa) WB, ELISA MO28769R 100 µg
Inquiry
MO-AB-06988H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06988C 100 µg
Inquiry
MO-AB-28382H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28382C 100 µg
Inquiry
MO-AB-09668Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09668Y 100 µg
Inquiry
MOFY-0722-FY43 Monoclonal Bovine, Human, Mouse WB, IHC, ICC, IP 100 µg
Inquiry
MOFY-0722-FY307 Polyclonal Bovine, Human, Pig, Goat, Sheep WB, IHC, ICC, IP 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus), Bovine, Human, Mouse, Pig, Goat, Sheep, Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO46323W
SpecificityThis antibody binds to Horse RBP4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.
Product OverviewMouse Anti-Horse RBP4 Antibody is a mouse antibody against RBP4. It can be used for RBP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRetinol-binding protein 4; Plasma retinol-binding protein; PRBP; RBP; RBP4
UniProt IDQ28369
Protein RefseqThe length of the protein is201 amino acids long.
The sequence is show below: MEWVWALVVLAALGSAGAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDEYGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLLNLDGTCADSYSFVFARDPNGFPPEVQRIVRRRQEELCLARQYRLISHNGYCDGKSDRNLL.
See other products for " Rbp4 "
CBMOAB-28843FYAMouse Anti-Rbp4 Antibody (CBMOAB-28843FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry