AibGenesis™ Mouse Anti-Rbp7 Antibody (MO-AB-28383H)


Cat: MO-AB-28383H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-28383H Monoclonal Rat (Rattus norvegicus), Marmoset, Pig (Sus scrofa) WB, ELISA MO28383C 100 µg
MO-AB-28772R Monoclonal Pig (Sus scrofa) WB, ELISA MO28772R 100 µg
MO-AB-63104W Monoclonal Marmoset WB, ELISA MO63104W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Marmoset, Pig (Sus scrofa)
CloneMO28383C
SpecificityThis antibody binds to Rat Rbp7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs. (From NCBI)
Product OverviewThis product is a mouse antibody against Rbp7. It can be used for Rbp7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Rbp7; Similar to retinoid binding protein 7; Rbp7
UniProt IDD4ABD9
Protein RefseqThe length of the protein is 134 amino acids long.
The sequence is show below: MPADLSGTWNLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFSINTCSSLRNYLLKFKVGEEFVEDNKGLDNRKCMSTVTWENDKLTCVQKGEKKNRGWSHWIEGDQLHLEMFCEGQVCKQTFQRA.
For Research Use Only | Not For Clinical Use.
Online Inquiry