AibGenesis™ Mouse Anti-rdh10 Antibody (MO-AB-07019H)


Cat: MO-AB-07019H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07019H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa) WB, ELISA MO07019C 100 µg
MO-AB-19157R Monoclonal Cattle (Bos taurus) WB, ELISA MO19157R 100 µg
MO-AB-20872W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20872W 100 µg
MO-AB-28779R Monoclonal Pig (Sus scrofa) WB, ELISA MO28779R 100 µg
MO-AB-63152W Monoclonal Marmoset WB, ELISA MO63152W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa)
CloneMO07019C
SpecificityThis antibody binds to Frog rdh10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a retinol dehydrogenase, which converts all-trans-retinol to all-trans-retinal, with preference for NADP as a cofactor. Studies in mice suggest that this protein is essential for synthesis of embryonic retinoic acid and is required for limb, craniofacial, and organ development. (From NCBI)
Product OverviewThis product is a mouse antibody against rdh10. It can be used for rdh10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRetinol dehydrogenase 10; rdh10
UniProt IDC3TWL9
Protein RefseqThe length of the protein is 341 amino acids long.
The sequence is show below: MHIVLEFFLVTFRVLWAFVLAAAKWFVRPKDKNVAGQVCLITGAGSGLGRLFALEFARRRAQLVLWDINPQSNEETADMVRDIYRQLQAEDSARRANSSADEEVLPCCNLQVYTYTCDVGKRESVYSTAERVRREVGDVYLLLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMEMNHGHIVSVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAADKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMRAILTDQPMICTPRLMYIVLCMKSILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNETKNGI.
For Research Use Only | Not For Clinical Use.
Online Inquiry