AibGenesis™ Mouse Anti-reep5 Antibody (CBMOAB-64046FYA)


Cat: CBMOAB-64046FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-64046FYA Monoclonal Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO64046FYA 100 µg
MO-AB-63168W Monoclonal Marmoset WB, ELISA MO63168W 100 µg
MO-AB-28405H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28405C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus)
CloneMO64046FYA
SpecificityThis antibody binds to Zebrafish reep5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish reep5 Antibody is a mouse antibody against reep5. It can be used for reep5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesReceptor accessory protein 5; reep5
UniProt IDQ6PBX9
Protein RefseqThe length of the protein is 189 amino acids long.
The sequence is show below: MAAALKQRFDNALHEKNMVTDLLAKIEAKTGVNRSYIAYAVIAFIAIYLVIGYGASLLCNLIGFVYPAYISIKAIESPAKDDDTKWLTYWVVYGVFSVVEFFADIFLSWFPFYFLAKCAFLVWCMAPTPSNGSIMLYTRIIRPFFLKNEAKIDNVMKDLTDKAAGAADKIKDEAKKATANIMFEEKKHY.
For Research Use Only | Not For Clinical Use.
Online Inquiry