Mouse Anti-REEP5 Antibody (MO-AB-19185R)


Cat: MO-AB-19185R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-19185R Monoclonal Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO19185R 100 µg
MO-AB-63168W Monoclonal Marmoset WB, ELISA MO63168W 100 µg
MO-AB-28405H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28405C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO19185R
SpecificityThis antibody binds to Cattle REEP5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionREEP5 (Receptor Accessory Protein 5) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and Olfactory Signaling Pathway. An important paralog of this gene is REEP6.
Product OverviewThis product is a mouse antibody against REEP5. It can be used for REEP5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesReceptor expression-enhancing protein 5; REEP5
UniProt IDQ29RM3
Protein RefseqThe length of the protein is 189 amino acids long.
The sequence is show below: MSAAMRQRFDQFLHQKNCMTDLLAKTEAKTGVNRSFIALGVIGLLALYLVFGYGASLLCNLIGFGYPAYVSIKAIESPNKEDDTQWLTYWVVYGVFSIVEFFSDLFLSWFPFYYMLKCGFLLWCMAPSPANGADLLYKRIIRPFFLKHESQVDNVVNDLKDKAKETADTISKEARKAAVSLLGEEKKST.
For Research Use Only | Not For Clinical Use.
Online Inquiry