AibGenesis™ Mouse Anti-RGS16 Antibody (CBMOAB-56422FYA)


Cat: CBMOAB-56422FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56422FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO56422FYA 100 µg
CBMOAB-95828FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95828FYA 100 µg
MO-AB-14539W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14539W 100 µg
MO-AB-19236R Monoclonal Cattle (Bos taurus) WB, ELISA MO19236R 100 µg
MO-AB-28454H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28454C 100 µg
MO-AB-28799R Monoclonal Pig (Sus scrofa) WB, ELISA MO28799R 100 µg
MO-AB-63252W Monoclonal Marmoset WB, ELISA MO63252W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO56422FYA
SpecificityThis antibody binds to Rhesus RGS16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade. (From NCBI)
Product OverviewMouse Anti-Rhesus RGS16 Antibody is a mouse antibody against RGS16. It can be used for RGS16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRGS16
UniProt IDF6W5V5
Protein RefseqThe length of the protein is 210 amino acids long.
The sequence is show below: QSALTRSLSDHPVGKDPQAMRTGQRQNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVLLSHKYGVAAFHAFLKTEFSEENLEFWLACEEFKKIQSATKRASRAHRIFEEFICSEAPKEVNIDHETRELTRMNLQTVTATCFDTAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATPSSCSLAEPSHT.
For Research Use Only | Not For Clinical Use.
Online Inquiry