AibGenesis™ Mouse Anti-RGS17 Antibody (CBMOAB-56423FYA)


Cat: CBMOAB-56423FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56423FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO56423FYA 100 µg
CBMOAB-95830FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95830FYA 100 µg
MO-AB-05641W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05641W 100 µg
MO-AB-19237R Monoclonal Cattle (Bos taurus) WB, ELISA MO19237R 100 µg
MO-AB-22668W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22668W 100 µg
MO-AB-28455H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28455C 100 µg
MO-AB-63253W Monoclonal Marmoset WB, ELISA MO63253W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO56423FYA
SpecificityThis antibody binds to Rhesus RGS17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal. (From NCBI)
Product OverviewMouse Anti-Rhesus RGS17 Antibody is a mouse antibody against RGS17. It can be used for RGS17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRegulator of G-protein signaling 17; RGS17
UniProt IDH9F198
Protein RefseqThe length of the protein is 175 amino acids long.
The sequence is show below: MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry