AibGenesis™ Mouse Anti-rgs9bp Antibody (CBMOAB-95876FYA)


Cat: CBMOAB-95876FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95876FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO95876FYA 100 µg
MO-AB-19251R Monoclonal Cattle (Bos taurus) WB, ELISA MO19251R 100 µg
MO-AB-28469H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28469C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO95876FYA
SpecificityThis antibody binds to Zebrafish rgs9bp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene functions as a regulator of G protein-coupled receptor signaling in phototransduction. Studies in bovine and mouse show that this gene is expressed only in the retina, and is localized in the rod outer segment membranes. This protein is associated with a heterotetrameric complex, specifically interacting with the regulator of G-protein signaling 9, and appears to function as the membrane anchor for the other largely soluble interacting partners. Mutations in this gene are associated with prolonged electroretinal response suppression (PERRS), also known as bradyopsia. (From NCBI)
Product OverviewMouse Anti-Zebrafish rgs9bp Antibody is a mouse antibody against rgs9bp. It can be used for rgs9bp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRegulator of G-protein-signaling 9-binding protein; rgs9b
UniProt IDE7EYT5
Protein RefseqThe length of the protein is 254 amino acids long.
The sequence is show below: MPLSNNKVADDGSSTQPLQEGKAMVDSLIKVVACYRHLASCVGGCTDSSSLRRDLRQTRERAQTLALSCRNHLTTRLRDKTLPEADRKEAEWLWVSFSSCLELLHADMSKVFAMAKHFSLANNSTMVQTGIQGGATEVAARALSLPDLQEAGAGTQTSSVEGQEQSQLEQEIAQVDRTLDDMEMKVNVLRWTVEAVGPQYTDPVSTDSTSLALLSMDEEAAQSFCSRSQMFAAMMLCGVAMFAVVLSVCVVFLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry