Mouse Anti-Rhesus APRT Antibody (MO-AB-01098W)


Cat: MO-AB-01098W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO01098W
SpecificityThis antibody binds to Rhesus APRT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAdenine phosphoribosyltransferase belongs to the purine / pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus APRT Antibody is a mouse antibody against APRT. It can be used for APRT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenine phosphoribosyltransferase isoform a; APRT
UniProt IDH9FMT2
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MADPELQLVERRIRSFPDFPTPGVLFRDISPVLKDPASFRAAIGLLARHLKVTHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTVWASYALEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMHAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE.
For Research Use Only | Not For Clinical Use.
Online Inquiry