Mouse Anti-Zebrafish aprt Antibody (CBMOAB-66219FYA)


Cat: CBMOAB-66219FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO66219FYA
SpecificityThis antibody binds to Zebrafish aprt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAdenine phosphoribosyltransferase belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish aprt Antibody is a mouse antibody against aprt. It can be used for aprt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenine phosphoribosyl transferase; apr
UniProt IDQ6PEI8
Protein RefseqThe length of the protein is 177 amino acids long.
The sequence is show below: MADKLELISKCIRTFPDFPTKGIPFKDIFPILKDPKAVTAVTDLFEEHVRNTYPQVDLIVGLDARGFLFGPLLALRLGIGFAPIRKKGKLPGPTISVAYSLEYAKAEAEMQEDAVSAGQKVLIIDDLLATGGTLYAAIELIKQQKAEVLGCLVVVELKYLNGSDKLKPTPVFSLIQY.
For Research Use Only | Not For Clinical Use.
Online Inquiry