Mouse Anti-Rhesus ATG13 Antibody (CBMOAB-36485FYA)


Cat: CBMOAB-36485FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO36485FYA
SpecificityThis antibody binds to Rhesus ATG13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an autophagy factor and a target of the TOR kinase signaling pathway. The encoded protein is essential for autophagosome formation and mitophagy.
Product OverviewMouse Anti-Rhesus ATG13 Antibody is a mouse antibody against ATG13. It can be used for ATG13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAutophagy-related protein 13; ATG13
UniProt IDF7CMJ2
Protein RefseqThe length of the protein is 551 amino acids long.
The sequence is show below: AMETDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLNGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQCVFTVTKAHFQTPTPVVTDTLRVPMAGLAFSHQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLASNQPVHGAQADQERLATCTPSDGTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPQTESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ.
See other products for " Atg13 "
MO-AB-14278YMouse Anti-Sheep Atg13 Antibody (MO-AB-14278Y)
MO-AB-29070WMouse Anti-Dog ATG13 Antibody (MO-AB-29070W)
CBMOAB-01987FYAMouse Anti-D. melanogaster Atg13 Antibody (CBMOAB-01987FYA)
MO-AB-51459WMouse Anti-Marmoset ATG13 Antibody (MO-AB-51459W)
MO-AB-00205YMouse Anti-Chicken ATG13 Antibody (MO-AB-00205Y)
MO-AB-43753WMouse Anti-Horse ATG13 Antibody (MO-AB-43753W)
MO-AB-22972HMouse Anti-Mallard ATG13 Antibody (MO-AB-22972H)
MO-AB-16879WMouse Anti-Chimpanzee ATG13 Antibody (MO-AB-16879W)
MO-AB-34428WMouse Anti-Ferret ATG13 Antibody (MO-AB-34428W)
MO-AB-00117LMouse Anti-Elephant ATG13 Antibody (MO-AB-00117L)
For Research Use Only | Not For Clinical Use.
Online Inquiry