Mouse Anti-Rhesus CCL5 Antibody (CBMOAB-38550FYA)
Cat: CBMOAB-38550FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta) |
| Clone | MO38550FYA |
| Specificity | This antibody binds to Rhesus CCL5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CCL5 (C-C Motif Chemokine Ligand 5) is a Protein Coding gene. Diseases associated with CCL5 include Ulcer Of Lower Limbs and Periapical Granuloma. Among its related pathways are PEDF Induced Signaling and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and chemokine activity. An important paralog of this gene is CCL3L3. |
| Product Overview | Mouse Anti-Rhesus CCL5 Antibody is a mouse antibody against CCL5. It can be used for CCL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Chemokine ligand 5; CCL5 |
| UniProt ID | A0MK18 |
| Protein Refseq | The length of the protein is 91 amino acids long. The sequence is show below: MKVSVAALAVILVATALCAPASASPHASDTTPCCFAYIARPLPRAHIKEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXKWVREYINSLEMS. |
See other products for " CCL5 "
| MO-AB-08665W | Mouse Anti-Cat CCL5 Antibody (MO-AB-08665W) |
| MO-AB-07469Y | Mouse Anti-Rabbit CCL5 Antibody (MO-AB-07469Y) |
| MO-AB-00188L | Mouse Anti-Elephant CCL5 Antibody (MO-AB-00188L) |
| MOFY-0722-FY77 | Rabbit Anti-CCL5 Antibody (MOFY-0722-FY77) |
| MO-AB-09703R | Mouse Anti-Cattle CCL5 Antibody (MO-AB-09703R) |
| MO-AB-43932W | Mouse Anti-Horse CCL5 Antibody (MO-AB-43932W) |
| MOFY-0722-FY230 | Rabbit Anti-CCL5 Antibody (MOFY-0722-FY230) |
| MO-AB-24591H | Mouse Anti-Rat Ccl5 Antibody (MO-AB-24591H) |
| MO-AB-34501W | Mouse Anti-Ferret CCL5 Antibody (MO-AB-34501W) |
| MO-AB-29418W | Mouse Anti-Dog CCL5 Antibody (MO-AB-29418W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry