Mouse Anti-Rhesus CLN3 Antibody (MO-AB-03536W)


Cat: MO-AB-03536W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO03536W
SpecificityThis antibody binds to Rhesus CLN3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is involved in lysosomal function. Mutations in this, as well as other neuronal ceroid-lipofuscinosis (CLN) genes, cause neurodegenerative diseases commonly known as Batten disease or collectively known as neuronal ceroid lipofuscinoses (NCLs). Many alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Rhesus CLN3 Antibody is a mouse antibody against CLN3. It can be used for CLN3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCLN3, Battenin; Ceroid-Lipofuscinosis, Neuronal 3; Batten Disease Protein; BTS; Juvenile Neuronal Ceroid Lipofuscinosis; Batten, Spielmeyer-Vogt Disease
UniProt IDF6YSZ0
Protein RefseqThe length of the protein is 105 amino acids long.
The sequence is show below: MGGCAGSRRRLSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWPCSWQTSSPRSSSNCWLLLAFTCCPTAPGFLSVGFVLLEASSWLPFLILWGPACVLFLVAHIS.
For Research Use Only | Not For Clinical Use.
Online Inquiry