Mouse Anti-Rhesus DPH5 Antibody (CBMOAB-41138FYA)


Cat: CBMOAB-41138FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO41138FYA
SpecificityThis antibody binds to Rhesus DPH5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a component of the diphthamide synthesis pathway. Diphthamide is a post-translationally modified histidine residue found only on translation elongation factor 2. It is conserved from archaebacteria to humans, and is targeted by diphtheria toxin and Pseudomonas exotoxin A to halt cellular protein synthesis. The yeast and Chinese hamster homologs of this protein catalyze the trimethylation of the histidine residue on elongation factor 2, resulting in a diphthine moiety that is subsequently amidated to yield diphthamide. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus DPH5 Antibody is a mouse antibody against DPH5. It can be used for DPH5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDPH5
UniProt IDF6S1G5
Protein RefseqThe length of the protein is 284 amino acids long.
The sequence is show below: MLYLIGLGLGDAKDITVKGLEAVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLILADREEVEQEADNILKDADISDVAFLVVGDPFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCFGFSYISLERQFLLFFGQTLGPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMSVNQAAQQLLEIIQNQRIRGEEPAITEETLCVGLARVGADDQKIAAGTLQQMCTVDLGEPLHSLIITGGSIHPIEMEMLNLFSIPENSSESQSIDGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry