AibGenesis™ Mouse Anti-Rhesus G6PC2 Antibody (CBMOAB-43272FYA)


Cat: CBMOAB-43272FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO43272FYA
SpecificityThis antibody binds to Rhesus G6PC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme belonging to the glucose-6-phosphatase catalytic subunit family. These enzymes are part of a multicomponent integral membrane system that catalyzes the hydrolysis of glucose-6-phosphate, the terminal step in gluconeogenic and glycogenolytic pathways, allowing the release of glucose into the bloodstream. The family member encoded by this gene is found in pancreatic islets and does not exhibit phosphohydrolase activity, but it is a major target of cell-mediated autoimmunity in diabetes. Several alternatively spliced transcript variants of this gene have been described, but their biological validity has not been determined. (From NCBI)
Product OverviewMouse Anti-Rhesus G6PC2 Antibody is a mouse antibody against G6PC2. It can be used for G6PC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesG6PC2
UniProt IDF6SZ02
Protein RefseqThe length of the protein is 358 amino acids long.
The sequence is show below: GFPHRNEVLIIQHLQKDYRAYYNFLNFMSNIGDPQNTFFIYFPLWFQLNQTVGTKMIWVAVIGDWFNLIFKWILFGHRPYWWVQETQIYPNDSSPCLEQFPTTCETGPGSPSGHAMGSSCVWYVMVTAALSHTVCGMDKFSITLHRNTLSLKQSIFFIYKILLMTCIAWILIFFMFWHTVIVSVSFQSSGMLVAEAFEHTPGIQMASLGTYLKTNLFLFLFAGFYLLLRLLNIDLLWSVPIAKKWCANPDWIHVDTTPFAGLVRNLGVLFGLGFAVNSEMFLLSCRGGYSYTLSFRLLCALTSLTTLHLYHFLQIPTQEEHLFYVLSFCKSASIPLTLVTFIPYYVHMLMKQNGKKIQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry