Mouse Anti-Rhesus IMPA1 Antibody (CBMOAB-45382FYA)


Cat: CBMOAB-45382FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO45382FYA
SpecificityThis antibody binds to Rhesus IMPA1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that dephosphorylates myo-inositol monophosphate to generate free myo-inositol, a precursor of phosphatidylinositol, and is therefore an important modulator of intracellular signal transduction via the production of the second messengers myoinositol 1,4,5-trisphosphate and diacylglycerol. This enzyme can also use myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. This enzyme shows magnesium-dependent phosphatase activity and is inhibited by therapeutic concentrations of lithium. Inhibition of inositol monophosphate hydroylosis and subsequent depletion of inositol for phosphatidylinositol synthesis may explain the anti-manic and anti-depressive effects of lithium administered to treat bipolar disorder. Alternative splicing results in multiple transcript variants encoding distinct isoforms. A pseudogene of this gene is also present on chromosome 8q21.13.
Product OverviewMouse Anti-Rhesus IMPA1 Antibody is a mouse antibody against IMPA1. It can be used for IMPA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIMPA1
UniProt IDF7H7A7
Protein RefseqThe length of the protein is 277 amino acids long.
The sequence is show below: MADPWQECMDYAVTLARRAGEVVCEALKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTNNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEDKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRIVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGILMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED.
For Research Use Only | Not For Clinical Use.
Online Inquiry