Mouse Anti-Rhesus MID1 Antibody (CBMOAB-51426FYA)
Cat: CBMOAB-51426FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO51426FYA |
Specificity | This antibody binds to Rhesus MID1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the tripartite motif (TRIM) family, also known as the 'RING-B box-coiled coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein forms homodimers which associate with microtubules in the cytoplasm. The protein is likely involved in the formation of multiprotein structures acting as anchor points to microtubules. Mutations in this gene have been associated with the X-linked form of Opitz syndrome, which is characterized by midline abnormalities such as cleft lip, laryngeal cleft, heart defects, hypospadias, and agenesis of the corpus callosum. This gene was also the first example of a gene subject to X inactivation in human while escaping it in mouse. Alternative promoter use, alternative splicing and alternative polyadenylation result in multiple transcript variants that have different tissue specificities. |
Product Overview | Mouse Anti-Rhesus MID1 Antibody is a mouse antibody against MID1. It can be used for MID1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | MID1 |
UniProt ID | F7CG48 |
Protein Refseq | The length of the protein is 56 amino acids long. The sequence is show below: MCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKKSCGLDRVI. |
See other products for " MID1 "
MO-AB-04413W | Mouse Anti-Rhesus MID1 Antibody (MO-AB-04413W) |
MO-AB-59089W | Mouse Anti-Marmoset MID1 Antibody (MO-AB-59089W) |
CBMOAB-02287CR | Mouse Anti-Yeast MID1 Antibody (CBMOAB-02287CR) |
CBMOAB-86915FYA | Mouse Anti-Zebrafish mid1 Antibody (CBMOAB-86915FYA) |
MO-AB-05175H | Mouse Anti-Frog mid1 Antibody (MO-AB-05175H) |
CBMOAB-23934FYA | Mouse Anti-D. melanogaster Mid1 Antibody (CBMOAB-23934FYA) |
MO-AB-16907W | Mouse Anti-Chimpanzee MID1 Antibody (MO-AB-16907W) |
MO-AB-02907Y | Mouse Anti-Chicken MID1 Antibody (MO-AB-02907Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry