Mouse Anti-Rhesus MID1 Antibody (CBMOAB-51426FYA)


Cat: CBMOAB-51426FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO51426FYA
SpecificityThis antibody binds to Rhesus MID1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the tripartite motif (TRIM) family, also known as the 'RING-B box-coiled coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein forms homodimers which associate with microtubules in the cytoplasm. The protein is likely involved in the formation of multiprotein structures acting as anchor points to microtubules. Mutations in this gene have been associated with the X-linked form of Opitz syndrome, which is characterized by midline abnormalities such as cleft lip, laryngeal cleft, heart defects, hypospadias, and agenesis of the corpus callosum. This gene was also the first example of a gene subject to X inactivation in human while escaping it in mouse. Alternative promoter use, alternative splicing and alternative polyadenylation result in multiple transcript variants that have different tissue specificities.
Product OverviewMouse Anti-Rhesus MID1 Antibody is a mouse antibody against MID1. It can be used for MID1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMID1
UniProt IDF7CG48
Protein RefseqThe length of the protein is 56 amino acids long.
The sequence is show below: MCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKKSCGLDRVI.
For Research Use Only | Not For Clinical Use.
Online Inquiry