Mouse Anti-MMP19 Antibody (CBMOAB-51533FYA)
Cat: CBMOAB-51533FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-51533FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) | WB, ELISA | MO51533FYA | 100 µg | ||
| MO-AB-15868R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15868R | 100 µg | ||
| MO-AB-20733W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20733W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) |
| Clone | MO51533FYA |
| Specificity | This antibody binds to Rhesus MMP19. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of a family of proteins that are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded protein is secreted as an inactive proprotein, which is activated upon cleavage by extracellular proteases. Alternative splicing results in multiple transcript variants for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus MMP19 Antibody is a mouse antibody against MMP19. It can be used for MMP19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | MMP19 |
| UniProt ID | F7HL17 |
| Protein Refseq | The length of the protein is 81 amino acids long. The sequence is show below: MNWQQLWLGFLLPMTVSGRVLGLAEEMAVEYLSQYGYLQKPLEGSNNFKPEDITEALRESPGPCRHPRAGQCALRRRRVLD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry