Mouse Anti-Rhesus OAT Antibody (CBMOAB-53274FYA)


Cat: CBMOAB-53274FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO53274FYA
SpecificityThis antibody binds to Rhesus OAT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the mitochondrial enzyme ornithine aminotransferase, which is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations that result in a deficiency of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. Alternatively spliced transcript variants encoding different isoforms have been described. Related pseudogenes have been defined on the X chromosome.
Product OverviewMouse Anti-Rhesus OAT Antibody is a mouse antibody against OAT. It can be used for OAT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOAT
UniProt IDF7BGF3
Protein RefseqThe length of the protein is 301 amino acids long.
The sequence is show below: MNTGVEAGETACKLARRWGYTVKGIQKYKAKIVFADGNFWGRTLSAISSSTDATSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLKEENLAENAEKLGIILRNELMKLPSDVVTAVRGKGLLNAIVIKETKDCDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKSILSF.
For Research Use Only | Not For Clinical Use.
Online Inquiry