Mouse Anti-Rhesus RPL23 Antibody (CBMOAB-56758FYA)
Cat: CBMOAB-56758FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO56758FYA |
Specificity | This antibody binds to Rhesus RPL23. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L14P family of ribosomal proteins. It is located in the cytoplasm. This gene has been referred to as rpL17 because the encoded protein shares amino acid identity with ribosomal protein L17 from Saccharomyces cerevisiae; however, its official symbol is RPL23. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Product Overview | Mouse Anti-Rhesus RPL23 Antibody is a mouse antibody against RPL23. It can be used for RPL23 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | RPL23 |
UniProt ID | F7HBU8 |
Protein Refseq | The length of the protein is 81 amino acids long. The sequence is show below: MVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNAGSIA. |
See other products for " rpl23 "
MO-AB-30509H | Mouse Anti-Sugar beet rpl23 Antibody (MO-AB-30509H) |
MO-AB-01917L | Mouse Anti-Bromus Rpl23 Antibody (MO-AB-01917L) |
MO-AB-70308W | Mouse Anti-Silkworm RpL23 Antibody (MO-AB-70308W) |
MO-AB-00001H | Mouse Anti-Arabidopsis rpl23 Antibody (MO-AB-00001H) |
MO-AB-28604H | Mouse Anti-Rat Rpl23 Antibody (MO-AB-28604H) |
MO-AB-28019W | Mouse Anti-Cottonwood rpl23 Antibody (MO-AB-28019W) |
CBMOAB-89163FYB | Mouse Anti-Rice rpl23 Antibody (CBMOAB-89163FYB) |
CBMOAB-96415FYA | Mouse Anti-Zebrafish rpl23 Antibody (CBMOAB-96415FYA) |
CBMOAB-09299HCB | Mouse Anti-C. elegans RPL23 Antibody (CBMOAB-09299HCB) |
MO-AB-33135W | Mouse Anti-Dog RPL23 Antibody (MO-AB-33135W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry