Mouse Anti-Rhesus SUMO1 Antibody (CBMOAB-59447FYA)
Cat: CBMOAB-59447FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO59447FYA |
Specificity | This antibody binds to Rhesus SUMO1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Required for the massive protein sumoylation in the nucleus induced by heat shock and controlled by SIZ1. Involved in the regulation of the heat stress transcription factor HSFA2 in acquired thermotolerance. |
Product Overview | Mouse Anti-Rhesus SUMO1 Antibody is a mouse antibody against SUMO1. It can be used for SUMO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | SMT3 suppressor of mif two 3-like 1; SUMO1 |
UniProt ID | Q3YAP2 |
Protein Refseq | The length of the protein is 60 amino acids long. The sequence is show below: MTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHS. |
See other products for " SUMO1 "
CBMOAB-89596FYB | Mouse Anti-Rice SUMO1 Antibody (CBMOAB-89596FYB) |
MO-AB-13357Y | Mouse Anti-O. mykiss SUMO1 Antibody (MO-AB-13357Y) |
MO-AB-46741W | Mouse Anti-Horse SUMO1 Antibody (MO-AB-46741W) |
CBMOAB-41932FYC | Mouse Anti-Arabidopsis SUMO1 Antibody (CBMOAB-41932FYC) |
MO-AB-23421W | Mouse Anti-Chimpanzee SUMO1 Antibody (MO-AB-23421W) |
MO-DKB-02516W | Rabbit Anti-SUMO1 Antibody (MO-DKB-02516W) |
MO-AB-65657W | Mouse Anti-Marmoset SUMO1 Antibody (MO-AB-65657W) |
MO-AB-29284H | Mouse Anti-Rat Sumo1 Antibody (MO-AB-29284H) |
MO-AB-38245W | Mouse Anti-Goat SUMO1 Antibody (MO-AB-38245W) |
MO-AB-21136R | Mouse Anti-Cattle SUMO1 Antibody (MO-AB-21136R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry