Mouse Anti-Rhesus TAC1 Antibody (CBMOAB-59644FYA)


Cat: CBMOAB-59644FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO59644FYA
SpecificityThis antibody binds to Rhesus TAC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with nerve receptors and smooth muscle cells. They are known to induce behavioral responses and function as vasodilators and secretagogues. Substance P is an antimicrobial peptide with antibacterial and antifungal properties. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus TAC1 Antibody is a mouse antibody against TAC1. It can be used for TAC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTAC1
UniProt IDF6VX72
Protein RefseqThe length of the protein is 114 amino acids long.
The sequence is show below: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWSDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDAGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR.
For Research Use Only | Not For Clinical Use.
Online Inquiry