Mouse Anti-Sheep TAC1 Antibody (MO-AB-17845Y)
Cat: MO-AB-17845Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Sheep (Ovis aries) |
| Clone | MO17845Y |
| Specificity | This antibody binds to Sheep TAC1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. |
| Product Overview | This product is a mouse antibody against TAC1. It can be used for TAC1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Tachykinin 1 isoform beta; TAC1 |
| UniProt ID | D2K8N7 |
| Protein Refseq | The length of the protein is 76 amino acids long. The sequence is show below: IARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQLSHKRHKTDSFVGLMGKRALNSVAYERSVMQDYERRRK. |
See other products for " TAC1 "
| MO-AB-21217R | Mouse Anti-Cattle TAC1 Antibody (MO-AB-21217R) |
| CBMOAB-08491FYB | Mouse Anti-Zebrafish tac1 Antibody (CBMOAB-08491FYB) |
| MO-AB-30561R | Mouse Anti-Pig TAC1 Antibody (MO-AB-30561R) |
| MO-AB-01712R | Mouse Anti-Medaka tac1 Antibody (MO-AB-01712R) |
| CBMOAB-11865HCB | Mouse Anti-C. elegans TAC1 Antibody (CBMOAB-11865HCB) |
| CBMOAB-44768FYC | Mouse Anti-Arabidopsis TAC1 Antibody (CBMOAB-44768FYC) |
| MO-AB-42668W | Mouse Anti-Guinea pig TAC1 Antibody (MO-AB-42668W) |
| MO-AB-08236H | Mouse Anti-Frog tac1 Antibody (MO-AB-08236H) |
| CBMOAB-59644FYA | Mouse Anti-Rhesus TAC1 Antibody (CBMOAB-59644FYA) |
| MO-AB-10155Y | Mouse Anti-Rabbit TAC1 Antibody (MO-AB-10155Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry