AibGenesis™ Mouse Anti-Rhesus WFDC10B Antibody (CBMOAB-62355FYA)
Cat: CBMOAB-62355FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta) |
| Clone | MO62355FYA |
| Specificity | This antibody binds to Rhesus WFDC10B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Two alternatively spliced transcript variants have been found for this gene, and they encode distinct isoforms. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus WFDC10B Antibody is a mouse antibody against WFDC10B. It can be used for WFDC10B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | WFDC10B |
| UniProt ID | F7DZZ8 |
| Protein Refseq | The length of the protein is 90 amino acids long. The sequence is show below: MVSCERRASKSVGQILLWDFGYTCRLSHRRMNSTEILSGNLPALYTGGIKVCEKRPSIDLCIHHCSYFQKCEANNICCSAFCGNVCMSIL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry