Mouse Anti-Rhesus WNT3 Antibody (CBMOAB-62413FYA)
Cat: CBMOAB-62413FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO62413FYA |
Specificity | This antibody binds to Rhesus WNT3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98% amino acid identity to mouse Wnt3 protein, and 84% to human WNT3A protein, another WNT gene product. The mouse studies show the requirement of Wnt3 in primary axis formation in the mouse. Studies of the gene expression suggest that this gene may play a key role in some cases of human breast, rectal, lung, and gastric cancer through activation of the WNT-beta-catenin-TCF signaling pathway. This gene is clustered with WNT15, another family member, in the chromosome 17q21 region. |
Product Overview | Mouse Anti-Rhesus WNT3 Antibody is a mouse antibody against WNT3. It can be used for WNT3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein Wnt; WNT3 |
UniProt ID | H9FC19 |
Protein Refseq | The length of the protein is 46 amino acids long. The sequence is show below: CDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK. |
See other products for " WNT3 "
MO-AB-01683L | Mouse Anti-Elephant WNT3 Antibody (MO-AB-01683L) |
MO-AB-14042Y | Mouse Anti-Sea-anemone WNT3 Antibody (MO-AB-14042Y) |
MO-AB-22984R | Mouse Anti-Cattle WNT3 Antibody (MO-AB-22984R) |
CBMOAB-16314FYB | Mouse Anti-Zebrafish wnt3 Antibody (CBMOAB-16314FYB) |
MO-AB-35985W | Mouse Anti-Ferret WNT3 Antibody (MO-AB-35985W) |
MO-AB-09524W | Mouse Anti-Cat WNT3 Antibody (MO-AB-09524W) |
MO-AB-34064W | Mouse Anti-Dog WNT3 Antibody (MO-AB-34064W) |
MO-AB-01926R | Mouse Anti-Medaka wnt3 Antibody (MO-AB-01926R) |
MO-AB-10498Y | Mouse Anti-Rabbit WNT3 Antibody (MO-AB-10498Y) |
MO-AB-42853W | Mouse Anti-Guinea pig WNT3 Antibody (MO-AB-42853W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry