AibGenesis™ Mouse Anti-Rhesus ZNF334 Antibody (MO-AB-07135W)


Cat: MO-AB-07135W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO07135W
SpecificityThis antibody binds to Rhesus ZNF334.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the C2H2 zinc finger family. The encoded protein contains a Krueppel-associated box, fourteen C2H2 zinc finger domains, and four C2H2-type/integrase DNA-binding domains. Decreased expression of this gene may be a marker for rheumatoid arthritis. Alternative splicing results in multiple transcript variants that encode different protein isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF334 Antibody is a mouse antibody against ZNF334. It can be used for ZNF334 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 334 isoform a; ZNF334
UniProt IDH9FBI1
Protein RefseqThe length of the protein is 279 amino acids long.
The sequence is show below: EKPYECSECEKTFFCQSALNVHRRSHTGEKPYECSQCGKFLCTKSALIAHQITHRGKKSYECNECGKFFCHKSTLTIHQRTHTGDKHGVFNKCGRISIMKSNCSQCKRMNTKENLYECSEHGHAISKNSHLIVHQRTIWERPYECNECGRTYCRKSALTHHQRTHTGERPYECNECGKTFCQKFSFVEHQRTHTGEKPYECNECGKSFCHKSAFRVHRRIHTGEKPYECNQCGKTYRRLWTLTEHQKIHTGEKPYECNKCEKTFRHKSNFLLHQKSHKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry