AibGenesis™ Mouse Anti-RHOXF2 Antibody (CBMOAB-56492FYA)


Cat: CBMOAB-56492FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56492FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO56492FYA 100 µg
MO-AB-16544W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16544W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO56492FYA
SpecificityThis antibody binds to Rhesus RHOXF2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RHOXF2 Antibody is a mouse antibody against RHOXF2. It can be used for RHOXF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRHOXF2 protein; RHOXF2
UniProt IDG9BBT8
Protein RefseqThe length of the protein is 283 amino acids long.
The sequence is show below: MEPLDQSSQDITSLLSLGVDYEKELQDMNAAVLSPTEEFKEEEEDAQSEPEQGTAAAGEESKLAGAQGGEEKDGGGGAGAPGLLWKENREGSSGSDGDDEDSDQSEKEPRQQDSPPPGAVGGLEPGNAQEPSVHAFTPLQLQELERIFQRKKYPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMPPLMVVGQPVMVTAVEAIMAPLSISRMRDGYFWGYSHPSTLCFSMSPFPPPSLPLPTVLFPPMPPPGRAQFGRFPFVIGHSFTFPNV.
For Research Use Only | Not For Clinical Use.
Online Inquiry