AibGenesis™ Mouse Anti-RIIAD1 Antibody (MO-AB-05671W)


Cat: MO-AB-05671W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05671W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO05671W 100 µg
MO-AB-19292R Monoclonal Cattle (Bos taurus) WB, ELISA MO19292R 100 µg
MO-AB-28508H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28508C 100 µg
MO-AB-63313W Monoclonal Marmoset WB, ELISA MO63313W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO05671W
SpecificityThis antibody binds to Rhesus RIIAD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RIIAD1 Antibody is a mouse antibody against RIIAD1. It can be used for RIIAD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRegulatory Subunit Of Type II PKA R-Subunit (RIIa) Domain Containing 1; C1orf230; RIIa Domain-Containing Protein ENSP00000357824; RIIa Domain-Containing Protein C1orf230; Chromosome 1 Open Reading Frame 230; RIIa Domain-Containing Protein 1; Non-Protein Coding RNA 166; NCRNA00166
UniProt IDF7D1Y1
Protein RefseqThe length of the protein is 137 amino acids long.
The sequence is show below: MLGVGDLVGAGRWGRGPENLPDSGGRLAEQALQGPSHPFSCLPPPEQILGAWRALKEELLSRAPSQFTLCTEVLQSSNLSQTPAVSPFVQSSVEMEKFLVPLSMFLSGERTWKLLLQVDFLNQGGEYYRNWRKRRRT.
For Research Use Only | Not For Clinical Use.
Online Inquiry