AibGenesis™ Mouse Anti-RILP Antibody (CBMOAB-56507FYA)


Cat: CBMOAB-56507FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56507FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO56507FYA 100 µg
CBMOAB-95982FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95982FYA 100 µg
MO-AB-07125H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07125C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO56507FYA
SpecificityThis antibody binds to Rhesus RILP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a lysosomal protein that interacts with RAB7, a small GTPase that controls transport to endocytic degradative compartments. Studies using mutant forms of the two proteins suggest that this protein represents a downstream effector for RAB7, and both proteins act together in the regulation of late endocytic traffic. A unique region of this protein has also been shown to be involved in the regulation of lysosomal morphology. (From NCBI)
Product OverviewMouse Anti-Rhesus RILP Antibody is a mouse antibody against RILP. It can be used for RILP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRILP
UniProt IDF7BU12
Protein RefseqThe length of the protein is 395 amino acids long.
The sequence is show below: MEPRRAVAPGWGSRETAGSGTAAELVYHLAGALGTELQELARRFGPEAAAGLVPLVVRALELLEQAAVGPAPDSLQVSAQQAEQELRRLREENERLRRELRAGPQEERTLLRQLKEVTDRQRDELRAHNRDLRQRGQETEALQEQLQRLLLVNAELRHKLAAVQIQLRAAQDRERERQQLGEAATPPAKEGAQGQAGAPGHQHVQEPEWMTAGAGASEDPAEAAQQLGRPSEAGQCFSREEFEQILQERNELKAKVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVRKQRKKIKAKMLGTPEEAESSDDEDGSWLLLSDDKGDHPPPPESKIQSFFGLWYRGKAESPEDETDSPAPSKLGGEEEAQPQSPAPDLPCSALHEHLCLGASATPEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry