AibGenesis™ Mouse Anti-RMI2 Antibody (CBMOAB-56566FYA)


Cat: CBMOAB-56566FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56566FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO56566FYA 100 µg
MO-AB-10288W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10288W 100 µg
MO-AB-19323R Monoclonal Cattle (Bos taurus) WB, ELISA MO19323R 100 µg
MO-AB-28522H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28522C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO56566FYA
SpecificityThis antibody binds to Rhesus RMI2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RMI2 Antibody is a mouse antibody against RMI2. It can be used for RMI2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRMI2
UniProt IDF6S766
Protein RefseqThe length of the protein is 147 amino acids long.
The sequence is show below: MAAAADSFSAGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHKNIP.
For Research Use Only | Not For Clinical Use.
Online Inquiry