AibGenesis™ Mouse Anti-RNASEH2C Antibody (MO-AB-16790W)


Cat: MO-AB-16790W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-16790W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO16790W 100 µg
MO-AB-19337R Monoclonal Cattle (Bos taurus) WB, ELISA MO19337R 100 µg
MO-AB-28540H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28540C 100 µg
MO-AB-63358W Monoclonal Marmoset WB, ELISA MO63358W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO16790W
SpecificityThis antibody binds to Chimpanzee RNASEH2C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a ribonuclease H subunit that can cleave ribonucleotides from RNA:DNA duplexes. Mutations in this gene cause Aicardi-Goutieres syndrome-3, a disease that causes severe neurologic dysfunction. A pseudogene for this gene has been identified on chromosome Y, near the sex determining region Y (SRY) gene. (From NCBI)
Product OverviewMouse Anti-Chimpanzee RNASEH2C Antibody is a mouse antibody against RNASEH2C. It can be used for RNASEH2C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibonuclease H2, subunit C; RNASEH2C
UniProt IDK7CFB0
Protein RefseqThe length of the protein is 164 amino acids long.
The sequence is show below: MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKEVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED.
For Research Use Only | Not For Clinical Use.
Online Inquiry