AibGenesis™ Mouse Anti-RNASET2 Antibody (CBMOAB-56577FYA)


Cat: CBMOAB-56577FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56577FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO56577FYA 100 µg
CBMOAB-96094FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96094FYA 100 µg
MO-AB-07148H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07148C 100 µg
MO-AB-14524W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14524W 100 µg
MO-AB-19340R Monoclonal Cattle (Bos taurus) WB, ELISA MO19340R 100 µg
MO-AB-63359W Monoclonal Marmoset WB, ELISA MO63359W 100 µg
MO-DKB-01573W Polyclonal Human (Homo sapiens), Rhesus (Macaca mulatta) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Marmoset, Zebrafish (Danio rerio)
CloneMO56577FYA
SpecificityThis antibody binds to Rhesus RNASET2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RNASET2 Antibody is a mouse antibody against RNASET2. It can be used for RNASET2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNASET2
UniProt IDF6VQF9
Protein RefseqThe length of the protein is 204 amino acids long.
The sequence is show below: MRPAALRGALLGCLYLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWQVPDKSEGCNRSWPFNLEEIKKNWMEIIDKQVPPSADLLPEMKAYWPDVIHSFPNRSRFCHGTCAAQVDALNSQKKYFGRSLELYRELDLNRWVRPSPCCSSQWGSLLSPKPDGWIQGNECRPRCPPAASACALFG.
For Research Use Only | Not For Clinical Use.
Online Inquiry