AibGenesis™ Mouse Anti-RNF135 Antibody (MO-AB-05688W)


Cat: MO-AB-05688W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05688W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO05688W 100 µg
MO-AB-12133W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12133W 100 µg
MO-AB-19359R Monoclonal Cattle (Bos taurus) WB, ELISA MO19359R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO05688W
SpecificityThis antibody binds to Rhesus RNF135.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported. (From NCBI)
Product OverviewMouse Anti-Rhesus RNF135 Antibody is a mouse antibody against RNF135. It can be used for RNF135 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesE3 ubiquitin-protein ligase RNF135 isoform 1; RNF135
UniProt IDH9F333
Protein RefseqThe length of the protein is 268 amino acids long.
The sequence is show below: NELSILGKVFSSGVDLSMTSPKLLISDTAAGRIRDILQDLEEIQEKLRENVARKEAPEAQTQGELPEAPSSSSCPLPDQSHPALKRASQFAQWAIHPTFNLKSLSCSLEVSTDSRTVTVSHRPQPYRWSCERFSTSQVLCSQALFSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTNQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISAASPLHPAFWLYGLHPGNHLIIKQVKV.
For Research Use Only | Not For Clinical Use.
Online Inquiry