AibGenesis™ Mouse Anti-RNF187 Antibody (CBMOAB-56635FYA)


Cat: CBMOAB-56635FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56635FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO56635FYA 100 µg
MO-AB-28558H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28558C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO56635FYA
SpecificityThis antibody binds to Rhesus RNF187.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RNF187 Antibody is a mouse antibody against RNF187. It can be used for RNF187 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesE3 ubiquitin-protein ligase RNF187; RNF187
UniProt IDH9FA64
Protein RefseqThe length of the protein is 154 amino acids long.
The sequence is show below: PARDGPASEAALQLLCRADAGPLCAACRMAAGPEPPEWEPRWRKALRGKENKGSVEIMRKDLNDARDLHGQAESAAAVWKGHVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDELADPTERFRSLLQAVSELEKKHRNLGLSMLLQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry