AibGenesis™ Mouse Anti-RNF208 Antibody (CBMOAB-56644FYA)


Cat: CBMOAB-56644FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56644FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO56644FYA 100 µg
MO-AB-07177H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07177C 100 µg
MO-AB-21873W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21873W 100 µg
MO-AB-63423W Monoclonal Marmoset WB, ELISA MO63423W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO56644FYA
SpecificityThis antibody binds to Rhesus RNF208.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RNF208 Antibody is a mouse antibody against RNF208. It can be used for RNF208 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNF208
UniProt IDF7EJ86
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MPALEGAPHTPPLPRRPRKGSTELGFPRVAPEDEVIVNQYVIRPGPSASAASSAAAGEPLECPTCGHTYNVTQRRPRVLSCLHSVCEQCLQILYESCPKYKFISCPTCRRETVLFTDYGLAALAVNTSILSRLPPEALTAPSGGQWGAEPEGSCYQTFRQYCGAACTCHVRNPLSACSIM.
For Research Use Only | Not For Clinical Use.
Online Inquiry