AibGenesis™ Mouse Anti-RNF217 Antibody (CBMOAB-56652FYA)


Cat: CBMOAB-56652FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56652FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO56652FYA 100 µg
CBMOAB-96204FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96204FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO56652FYA
SpecificityThis antibody binds to Rhesus RNF217.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RNF217 Antibody is a mouse antibody against RNF217. It can be used for RNF217 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative E3 ubiquitin-protein ligase RNF217; RNF217
UniProt IDH9FK19
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: LGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHEGVNCKEYKKGDKLLRHWASEIEHGQRNAQKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGERYRQLRFFGDHTSNLSIFGCKYRYLPERPHLRRLVRGSVCAGKLFIAPLIMVLGLALGAIAVVIG.
For Research Use Only | Not For Clinical Use.
Online Inquiry