AibGenesis™ Mouse Anti-RNF7 Antibody (CBMOAB-56675FYA)
Cat: CBMOAB-56675FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-56675FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO56675FYA | 100 µg | ||
| CBMOAB-96242FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96242FYA | 100 µg | ||
| MO-AB-05699W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO05699W | 100 µg | ||
| MO-AB-07190H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07190C | 100 µg | ||
| MO-AB-11530W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11530W | 100 µg | ||
| MO-AB-19407R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19407R | 100 µg | ||
| MO-AB-28564H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28564C | 100 µg | ||
| MO-AB-63452W | Monoclonal | Marmoset | WB, ELISA | MO63452W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO56675FYA |
| Specificity | This antibody binds to Rhesus RNF7. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII). The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Alternatively spliced transcript variants encoding distinct isoforms have been reported. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus RNF7 Antibody is a mouse antibody against RNF7. It can be used for RNF7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | RNF7 |
| UniProt ID | F7H411 |
| Protein Refseq | The length of the protein is 71 amino acids long. The sequence is show below: MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDEGIGVRNWSKAM. |
For Research Use Only | Not For Clinical Use.
Online Inquiry