AibGenesis™ Mouse Anti-ROPN1L Antibody (CBMOAB-56707FYA)


Cat: CBMOAB-56707FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56707FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO56707FYA 100 µg
CBMOAB-96306FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96306FYA 100 µg
MO-AB-05710W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05710W 100 µg
MO-AB-19434R Monoclonal Cattle (Bos taurus) WB, ELISA MO19434R 100 µg
MO-AB-28568H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28568C 100 µg
MO-AB-63473W Monoclonal Marmoset WB, ELISA MO63473W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO56707FYA
SpecificityThis antibody binds to Rhesus ROPN1L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ropporin family. The encoded protein is present in sperm and interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ROPN1L Antibody is a mouse antibody against ROPN1L. It can be used for ROPN1L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesROPN1L
UniProt IDF6ZPF3
Protein RefseqThe length of the protein is 198 amino acids long.
The sequence is show below: MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLQWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTGLTPGLLKILHKQCHHKQYVELTDLEQKWKNLCLPKEKFKALLQLDPCENRIKWINFLALGCSMLGGSLNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLAKLDSDVSSSETESYLASLKENM.
For Research Use Only | Not For Clinical Use.
Online Inquiry