AibGenesis™ Mouse Anti-RPL28 Antibody (CBMOAB-03522CR)
Cat: CBMOAB-03522CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-03522CR | Monoclonal | Yeast, A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Silkworm (Bombyx mori), Zebrafish (Danio rerio) | WB, ELISA | MO03522CR | 100 µg | ||
| CBMOAB-09306HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO09306HB | 100 µg | ||
| CBMOAB-29996FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO29996FYA | 100 µg | ||
| CBMOAB-40403FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO40403FC | 100 µg | ||
| CBMOAB-96427FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96427FYA | 100 µg | ||
| MO-AB-05719W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO05719W | 100 µg | ||
| MO-AB-07240H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07240C | 100 µg | ||
| MO-AB-19500R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19500R | 100 µg | ||
| MO-AB-28612H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28612C | 100 µg | ||
| MO-AB-70314W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70314W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Silkworm (Bombyx mori), Zebrafish (Danio rerio) |
| Clone | MO03522CR |
| Specificity | This antibody binds to Yeast RPL28. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast RPL28 Antibody is a mouse antibody against RPL28. It can be used for RPL28 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 60S ribosomal protein L28; L27a; L29; RP44; RP62; YL24; RPL28; CYH2; YGL103W |
| UniProt ID | P02406 |
| Protein Refseq | The length of the protein is 149 amino acids long. The sequence is show below: MPSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPGYFGKVGMRYFHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIPNVPVIVKARFVSKLAEEKIRAAGGVVELIA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry