AibGenesis™ Mouse Anti-RPL31 Antibody (CBMOAB-09314HCB)
Cat: CBMOAB-09314HCB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-09314HCB | Monoclonal | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio), Silkworm (Bombyx mori) | WB, ELISA | MO09314HB | 100 µg | ||
| CBMOAB-30004FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO30004FYA | 100 µg | ||
| CBMOAB-40413FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO40413FC | 100 µg | ||
| CBMOAB-96433FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96433FYA | 100 µg | ||
| MO-AB-05721W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO05721W | 100 µg | ||
| MO-AB-19505R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19505R | 100 µg | ||
| MO-AB-28616H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28616C | 100 µg | ||
| MO-AB-70319W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70319W | 100 µg | ||
| MO-DKB-01618W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio), Silkworm (Bombyx mori) |
| Clone | MO09314HB |
| Specificity | This antibody binds to C. elegans RPL31. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L31E family of ribosomal proteins. It is located in the cytoplasm. Higher levels of expression of this gene in familial adenomatous polyps compared to matched normal tissues have been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-C. elegans RPL31 Antibody is a mouse antibody against RPL31. It can be used for RPL31 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 60S ribosomal protein L31; rpl-31 |
| UniProt ID | Q9U332 |
| Protein Refseq | The length of the protein is 122 amino acids long. The sequence is show below: MAPKNEKKSRSTINEVVTREYTIHIHARIRGIGSKKRAPRAIDEIKKFAKIQMKTNDVRVDTKLNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVDSEE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry