AibGenesis™ Mouse Anti-RPL31 Antibody (CBMOAB-09314HCB)


Cat: CBMOAB-09314HCB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09314HCB Monoclonal C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio), Silkworm (Bombyx mori) WB, ELISA MO09314HB 100 µg
CBMOAB-30004FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO30004FYA 100 µg
CBMOAB-40413FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO40413FC 100 µg
CBMOAB-96433FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96433FYA 100 µg
MO-AB-05721W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05721W 100 µg
MO-AB-19505R Monoclonal Cattle (Bos taurus) WB, ELISA MO19505R 100 µg
MO-AB-28616H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28616C 100 µg
MO-AB-70319W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70319W 100 µg
MO-DKB-01618W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio), Silkworm (Bombyx mori)
CloneMO09314HB
SpecificityThis antibody binds to C. elegans RPL31.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L31E family of ribosomal proteins. It is located in the cytoplasm. Higher levels of expression of this gene in familial adenomatous polyps compared to matched normal tissues have been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-C. elegans RPL31 Antibody is a mouse antibody against RPL31. It can be used for RPL31 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names60S ribosomal protein L31; rpl-31
UniProt IDQ9U332
Protein RefseqThe length of the protein is 122 amino acids long. The sequence is show below: MAPKNEKKSRSTINEVVTREYTIHIHARIRGIGSKKRAPRAIDEIKKFAKIQMKTNDVRVDTKLNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVDSEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry