AibGenesis™ Mouse Anti-RPL36 Antibody (CBMOAB-09320HCB)
Cat: CBMOAB-09320HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-09320HCB | Monoclonal | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Grape (Vitis vinifera), Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), O. anatinus (Ornithorhynchus anatinus), Rat (Rattus norvegicus), Rice (Oryza), Sheep (Ovis aries), Silkworm (Bombyx mori), Sugar beet (Beta vulgaris), Zebrafish (Danio rerio) | WB, ELISA | MO09320HB | 100 µg | ||
| CBMOAB-30015FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO30015FYA | 100 µg | ||
| CBMOAB-40434FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO40434FC | 100 µg | ||
| CBMOAB-89173FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89173FYB | 100 µg | ||
| CBMOAB-96440FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96440FYA | 100 µg | ||
| MO-AB-00548W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00548W | 100 µg | ||
| MO-AB-01513R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01513R | 100 µg | ||
| MO-AB-01919L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01919L | 100 µg | ||
| MO-AB-06848Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06848Y | 100 µg | ||
| MO-AB-09577W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09577W | 100 µg | ||
| MO-AB-12694W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12694W | 100 µg | ||
| MO-AB-17505Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17505Y | 100 µg | ||
| MO-AB-19510R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19510R | 100 µg | ||
| MO-AB-28624H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28624C | 100 µg | ||
| MO-AB-30512H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30512C | 100 µg | ||
| MO-AB-39473W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO39473W | 100 µg | ||
| MO-AB-42481W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42481W | 100 µg | ||
| MO-AB-63531W | Monoclonal | Marmoset | WB, ELISA | MO63531W | 100 µg | ||
| MO-AB-70323W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70323W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Grape (Vitis vinifera), Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), O. anatinus (Ornithorhynchus anatinus), Rat (Rattus norvegicus), Rice (Oryza), Sheep (Ovis aries), Silkworm (Bombyx mori), Sugar beet (Beta vulgaris), Zebrafish (Danio rerio) |
| Clone | MO09320HB |
| Specificity | This antibody binds to C. elegans RPL36. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L36E family of ribosomal proteins. It is located in the cytoplasm. Transcript variants derived from alternative splicing exist; they encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (From NCBI) |
| Product Overview | Mouse Anti-C. elegans RPL36 Antibody is a mouse antibody against RPL36. It can be used for RPL36 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 60S ribosomal protein L36; rpl-36 |
| UniProt ID | P49181 |
| Protein Refseq | The length of the protein is 104 amino acids long. The sequence is show below: MSGPGIEGLAVGLNKGHAATQLPVKQRQNRHKGVASKKTKIVRELVREITGFAPYERRVLEMLRISKDKRALKFLKRRIGTHRRAKGKREELQNVIIAQRKAHK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry