AibGenesis™ Mouse Anti-RPL37 Antibody (CBMOAB-09321HCB)
Cat: CBMOAB-09321HCB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-09321HCB | Monoclonal | WB, ELISA | MO09321HB | 100 µg | |||
| CBMOAB-56768FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO56768FYA | 100 µg | ||
| CBMOAB-96442FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96442FYA | 100 µg | ||
| MO-AB-01284L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01284L | 100 µg | ||
| MO-AB-03852Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03852Y | 100 µg | ||
| MO-AB-06849Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06849Y | 100 µg | ||
| MO-AB-07251H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07251C | 100 µg | ||
| MO-AB-17506Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17506Y | 100 µg | ||
| MO-AB-19513R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19513R | 100 µg | ||
| MO-AB-25403W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25403W | 100 µg | ||
| MO-AB-28626H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28626C | 100 µg | ||
| MO-AB-32480H | Monoclonal | Soybean (Glycine max) | WB, ELISA | MO32480C | 100 µg | ||
| MO-AB-33141W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33141W | 100 µg | ||
| MO-AB-38733W | Monoclonal | Gorilla | WB, ELISA | MO38733W | 100 µg | ||
| MO-AB-63533W | Monoclonal | Marmoset | WB, ELISA | MO63533W | 100 µg | ||
| MO-AB-70325W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70325W | 100 µg | ||
| MO-DKB-0464RA | Polyclonal | WB | 50 µL |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana); C. reinhardtii (Chlamydomonas reinhardtii), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Gorilla, Marmoset, O. anatinus (Ornithorhynchus anatinus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Silkworm (Bombyx mori), Soybean (Glycine max), Zebrafish (Danio rerio) |
| Clone | MO09321HB |
| Specificity | This antibody binds to C. elegans RPL37. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L37E family of ribosomal proteins. It is located in the cytoplasm. The protein contains a C2C2-type zinc finger-like motif. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (From NCBI) |
| Product Overview | Mouse Anti-C. elegans RPL37 Antibody is a mouse antibody against RPL37. It can be used for RPL37 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 60S ribosomal protein L37; rpl-37 |
| UniProt ID | P49622 |
| Protein Refseq | The length of the protein is 91 amino acids long. The sequence is show below: MTKGTQAFGKKHVKSHTLCKRCGKSSFHIQKKRCASCGYQDAKKRTYNWGAKSIRRRTTGTGRTRHLRDVNARFRNGFRGTTPKPRAQPTN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry