AibGenesis™ Mouse Anti-RPL37 Antibody (CBMOAB-09321HCB)


Cat: CBMOAB-09321HCB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09321HCB Monoclonal WB, ELISA MO09321HB 100 µg
CBMOAB-56768FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO56768FYA 100 µg
CBMOAB-96442FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96442FYA 100 µg
MO-AB-01284L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01284L 100 µg
MO-AB-03852Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03852Y 100 µg
MO-AB-06849Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06849Y 100 µg
MO-AB-07251H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07251C 100 µg
MO-AB-17506Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17506Y 100 µg
MO-AB-19513R Monoclonal Cattle (Bos taurus) WB, ELISA MO19513R 100 µg
MO-AB-25403W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25403W 100 µg
MO-AB-28626H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28626C 100 µg
MO-AB-32480H Monoclonal Soybean (Glycine max) WB, ELISA MO32480C 100 µg
MO-AB-33141W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33141W 100 µg
MO-AB-38733W Monoclonal Gorilla WB, ELISA MO38733W 100 µg
MO-AB-63533W Monoclonal Marmoset WB, ELISA MO63533W 100 µg
MO-AB-70325W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70325W 100 µg
MO-DKB-0464RA Polyclonal WB 50 µL

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana); C. reinhardtii (Chlamydomonas reinhardtii), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Gorilla, Marmoset, O. anatinus (Ornithorhynchus anatinus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Silkworm (Bombyx mori), Soybean (Glycine max), Zebrafish (Danio rerio)
CloneMO09321HB
SpecificityThis antibody binds to C. elegans RPL37.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L37E family of ribosomal proteins. It is located in the cytoplasm. The protein contains a C2C2-type zinc finger-like motif. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (From NCBI)
Product OverviewMouse Anti-C. elegans RPL37 Antibody is a mouse antibody against RPL37. It can be used for RPL37 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names60S ribosomal protein L37; rpl-37
UniProt IDP49622
Protein RefseqThe length of the protein is 91 amino acids long. The sequence is show below: MTKGTQAFGKKHVKSHTLCKRCGKSSFHIQKKRCASCGYQDAKKRTYNWGAKSIRRRTTGTGRTRHLRDVNARFRNGFRGTTPKPRAQPTN.
For Research Use Only | Not For Clinical Use.
Online Inquiry