AibGenesis™ Mouse Anti-RPL37A Antibody (CBMOAB-03539CR)
Cat: CBMOAB-03539CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-03539CR | Monoclonal | Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus), Silkworm (Bombyx mori) | WB, ELISA | MO03539CR | 100 µg | ||
| CBMOAB-30021FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO30021FYA | 100 µg | ||
| CBMOAB-40439FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO40439FC | 100 µg | ||
| MO-AB-19514R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19514R | 100 µg | ||
| MO-AB-28627H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28627C | 100 µg | ||
| MO-AB-70326W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70326W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus), Silkworm (Bombyx mori) |
| Clone | MO03539CR |
| Specificity | This antibody binds to Yeast RPL37A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast RPL37A Antibody is a mouse antibody against RPL37A. It can be used for RPL37A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 60S ribosomal protein L37-A; L43; YL35; YP55; RPL37A; RPL35A; YLR185W |
| UniProt ID | P49166 |
| Protein Refseq | The length of the protein is 88 amino acids long. The sequence is show below: MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKASA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry