AibGenesis™ Mouse Anti-rpl7l1 Antibody (CBMOAB-96458FYA)


Cat: CBMOAB-96458FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-96458FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO96458FYA 100 µg
MO-AB-05723W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05723W 100 µg
MO-AB-07261H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07261C 100 µg
MO-AB-18910W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18910W 100 µg
MO-AB-19525R Monoclonal Cattle (Bos taurus) WB, ELISA MO19525R 100 µg
MO-AB-28634H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28634C 100 µg
MO-AB-63540W Monoclonal Marmoset WB, ELISA MO63540W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO96458FYA
SpecificityThis antibody binds to Zebrafish rpl7l1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish rpl7l1 Antibody is a mouse antibody against rpl7l1. It can be used for rpl7l1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibosomal protein L7-like 1; rpl7l
UniProt IDQ6PFJ0
Protein RefseqThe length of the protein is 247 amino acids long.
The sequence is show below: MAEPGTEKVIKLVPENLLKKRKAYQAIKANQAKLALQQKKRVQKGIPFKFKRLEEFLQNSRRKHRDETRLARLKKRPPPPMPPAKNSLAFAVRIREIKGVSPKVMNVIQMLRLRKIFSGTFVKVSKHSINMLKTVEPYVAWGYPNLKSVRELILKRGQGKVDKRKIPLTDNTLIEQHLGKYGIICLEDLIHEIYSAGKNFRVVNNFLWPFRLSVPRHAARDKVGLMKDVGNPGPRAEDINTVIRKLN.
For Research Use Only | Not For Clinical Use.
Online Inquiry